SLC29A2 Antikörper

Produktnummer ABIN635738

Produktdetails anti-SLC29A2 Antikörper

Target: SLC29A2 (Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC29A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC29 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC29A2 Blocking Peptide, catalog no. 33R-7199, is also available for use as a blocking control in assays to test for specificity of this SLC29A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC29A2

Target: SLC29A2 (Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2))

Andere Bezeichnung: SLC29A2 (SLC29A2 Produkte)

Synonyme: DER12 antikoerper, ENT2 antikoerper, HNP36 antikoerper, Der12 antikoerper, Ent2 antikoerper, Hnp36 antikoerper, ent2 antikoerper, der12 antikoerper, hnp36 antikoerper, MGC82995 antikoerper, DKFZp468L038 antikoerper, zgc:110527 antikoerper, solute carrier family 29 member 2 antikoerper, solute carrier family 29 (nucleoside transporters), member 2 antikoerper, solute carrier family 29 (equilibrative nucleoside transporter), member 2 L homeolog antikoerper, solute carrier family 29 (equilibrative nucleoside transporter), member 2 antikoerper, SLC29A2 antikoerper, Slc29a2 antikoerper, slc29a2.L antikoerper, slc29a2 antikoerper

Hintergrund: SLC29A2 mediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. It is less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine.

Molekulargewicht: 50 kDa (MW of target protein)