SLC29A2 Antikörper

Produktnummer ABIN635738

Der Kaninchen Polyklonal Anti-SLC29A2-Antikörper wurde für WB validiert. Er ist geeignet, SLC29A2 in Proben von Human zu detektieren.

Kurzübersicht für SLC29A2 Antikörper (ABIN635738)

Target: SLC29A2 (Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC29A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC29A2 Antikörper

Aufreinigung: Affinity purified

Immunogen: SLC29 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC29A2 Blocking Peptide, (ABIN5616234), is also available for use as a blocking control in assays to test for specificity of this SLC29A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC29A2

Target: SLC29A2 (Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2))

Andere Bezeichnung: SLC29A2

Hintergrund: SLC29A2 mediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. It is less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine.

Molekulargewicht: 50 kDa (MW of target protein)