DNASE2B Antikörper (N-Term)

Produktnummer ABIN635735

Der Kaninchen Polyklonal Anti-DNASE2B-Antikörper wurde für WB validiert. Er ist geeignet, DNASE2B in Proben von Human zu detektieren.

Kurzübersicht für DNASE2B Antikörper (N-Term) (ABIN635735)

Target: DNASE2B (Deoxyribonuclease II beta (DNASE2B))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DNASE2B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DNASE2B Antikörper

Bindungsspezifität: N-Term

Spezifität: DNASE2 B antibody was raised against the N terminal of DNASE2

Aufreinigung: Affinity purified

Immunogen: DNASE2 B antibody was raised using the N terminal of DNASE2 corresponding to a region with amino acids EGKAVDWFTFYKLPKRQNKESGETGLEYLYLDSTTRSWRKSEQLMNDTKS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DNASE2B Blocking Peptide, (ABIN937819), is also available for use as a blocking control in assays to test for specificity of this DNASE2B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNASE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DNASE2B

Target: DNASE2B (Deoxyribonuclease II beta (DNASE2B))

Andere Bezeichnung: DNASE2B

Hintergrund: DNASE2B shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this protein is restricted to the salivary gland and lungs. The protein encoded by this gene shares considerable sequence similarity to, and is structurally related to DNase II.

Molekulargewicht: 39 kDa (MW of target protein)