GAL3ST3 Antikörper (C-Term)

Produktnummer ABIN635734

Produktdetails anti-GAL3ST3 Antikörper

Target: GAL3ST3 (Galactose-3-O-Sulfotransferase 3 (GAL3ST3))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GAL3ST3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GAL3 ST3 antibody was raised against the C terminal of GAL3 T3

Aufreinigung: Affinity purified

Immunogen: GAL3 ST3 antibody was raised using the C terminal of GAL3 T3 corresponding to a region with amino acids VDIMGYDLPGGGAGPATEACLKLAMPEVQYSNYLLRKQKRRGGARARPEP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GAL3ST3 Blocking Peptide, catalog no. 33R-9463, is also available for use as a blocking control in assays to test for specificity of this GAL3ST3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAL0 T3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GAL3ST3

Target: GAL3ST3 (Galactose-3-O-Sulfotransferase 3 (GAL3ST3))

Andere Bezeichnung: GAL3ST3 (GAL3ST3 Produkte)

Synonyme: GAL3ST-3 antikoerper, GAL3ST2 antikoerper, galactose-3-O-sulfotransferase 3 antikoerper, GAL3ST3 antikoerper, Gal3st3 antikoerper

Hintergrund: GAL3ST3 is a member of the galactose-3-O-sulfotransferase protein family. It catalyzes sulfonation by transferring a sulfate group to the 3' position of galactose in N-acetyllactosamine in both type 2 (Gal-beta-1-4GlcNAc-R) oligosaccharides and core-2-branched O-glycans, but not on type 1 or core-1-branched structures. This gene is different from the GAL3ST2 gene located on chromosome 2 that encodes a related enzyme with distinct tissue distribution and substrate specificities, compared to galactose-3-O-sulfotransferase 3.

Molekulargewicht: 49 kDa (MW of target protein)