ACSL4 Antikörper (N-Term)

Produktnummer ABIN635728

Produktdetails anti-ACSL4 Antikörper

Target: ACSL4 (Acyl-CoA Synthetase Long-Chain Family Member 4 (ACSL4))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACSL4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACSL4 antibody was raised against the N terminal of ACSL4

Aufreinigung: Affinity purified

Immunogen: ACSL4 antibody was raised using the N terminal of ACSL4 corresponding to a region with amino acids AKRIKAKPTSDKPGSPYRSVTHFDSLAVIDIPGADTLDKLFDHAVSKFGK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACSL4 Blocking Peptide, catalog no. 33R-1307, is also available for use as a blocking control in assays to test for specificity of this ACSL4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSL4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACSL4

Target: ACSL4 (Acyl-CoA Synthetase Long-Chain Family Member 4 (ACSL4))

Andere Bezeichnung: ACSL4 (ACSL4 Produkte)

Synonyme: acsl4 antikoerper, zgc:66186 antikoerper, ACSL4 antikoerper, ACS4 antikoerper, FACL4 antikoerper, LACS4 antikoerper, MRX63 antikoerper, MRX68 antikoerper, 9430020A05Rik antikoerper, AU018108 antikoerper, Facl4 antikoerper, Lacs4 antikoerper, Acs4 antikoerper, acs4 antikoerper, acsl3 antikoerper, facl4 antikoerper, lacs4 antikoerper, mrx63 antikoerper, mrx68 antikoerper, T32A16.20 antikoerper, T32A16_20 antikoerper, long-chain acyl-CoA synthetase 4 antikoerper, acyl-CoA synthetase long chain family member 4a antikoerper, acyl-CoA synthetase long-chain family member 4 antikoerper, acyl-CoA synthetase long chain family member 4 antikoerper, AcsL4 antikoerper, acyl-CoA synthetase long chain family member 3 antikoerper, Long-chain-fatty-acid--CoA ligase 4 antikoerper, acyl-CoA synthetase long-chain family member 4 S homeolog antikoerper, AMP-dependent synthetase and ligase family protein antikoerper, acsl4a antikoerper, ACSL4 antikoerper, acsL4 antikoerper, acsl3 antikoerper, acsl4 antikoerper, Acsl4 antikoerper, acsl4.S antikoerper, LACS4 antikoerper

Hintergrund: ACSL4 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme preferentially utilizes arachidonate as substrate. The absence of this enzyme may contribute to the mental retardation or Alport syndrome. Alternative splicing of this gene generates 2 transcript variants.

Molekulargewicht: 74 kDa (MW of target protein)