SLC37A1 Antikörper

Produktnummer ABIN635725

Produktdetails anti-SLC37A1 Antikörper

Target: SLC37A1 (Solute Carrier Family 37 Member 1 (SLC37A1))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC37A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC37 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKIPGVIEFSLCLLFAKLVSYTFLFWLPLYITNVDHLDAKKAGELSTLFD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC37A1 Blocking Peptide, catalog no. 33R-5087, is also available for use as a blocking control in assays to test for specificity of this SLC37A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC37A1

Target: SLC37A1 (Solute Carrier Family 37 Member 1 (SLC37A1))

Andere Bezeichnung: SLC37A1 (SLC37A1 Produkte)

Synonyme: MGC53019 antikoerper, G3PP antikoerper, zgc:101659 antikoerper, solute carrier family 37 (glucose-6-phosphate transporter), member 1 L homeolog antikoerper, solute carrier family 37 member 1 antikoerper, solute carrier family 37 (glucose-6-phosphate transporter), member 1 antikoerper, solute carrier family 37 (glycerol-3-phosphate transporter), member 1 antikoerper, slc37a1.L antikoerper, SLC37A1 antikoerper, Slc37a1 antikoerper, slc37a1 antikoerper

Hintergrund: SLC37A1, a member of the sugar-phosphate transport family, transports glycerol-3-phosphate (G3P) between cellular compartments for its utilization in several compartment-specific biochemical pathways.SLC37A1, a member of the sugar-phosphate transport family, transports glycerol-3-phosphate (G3P) between cellular compartments for its utilization in several compartment-specific biochemical pathways.

Molekulargewicht: 58 kDa (MW of target protein)