GAA Antikörper (N-Term)

Produktnummer ABIN635720

Der Kaninchen Polyklonal Anti-GAA-Antikörper wurde für WB validiert. Er ist geeignet, GAA in Proben von Human zu detektieren.

Kurzübersicht für GAA Antikörper (N-Term) (ABIN635720)

Target: GAA (Glucosidase, Alpha, Acid (GAA))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GAA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GAA Antikörper

Bindungsspezifität: N-Term

Spezifität: GAA antibody was raised against the N terminal of GAA

Aufreinigung: Affinity purified

Immunogen: GAA antibody was raised using the N terminal of GAA corresponding to a region with amino acids FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GAA Blocking Peptide, (ABIN938303), is also available for use as a blocking control in assays to test for specificity of this GAA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GAA

Target: GAA (Glucosidase, Alpha, Acid (GAA))

Andere Bezeichnung: GAA

Hintergrund: GAA is acid alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. Different forms of acid alpha-glucosidase are obtained by proteolytic processing. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum.

Molekulargewicht: 98 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process