SLC45A3 Antikörper (Middle Region)

Produktnummer ABIN635719

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch SLC45A3 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für SLC45A3 Antikörper (Middle Region) (ABIN635719)

Target: SLC45A3 (Solute Carrier Family 45, Member 3 (SLC45A3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC45A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC45A3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SLC45 A3 antibody was raised against the middle region of SLC45 3

Aufreinigung: Affinity purified

Immunogen: SLC45 A3 antibody was raised using the middle region of SLC45 3 corresponding to a region with amino acids LFYTDFVGEGLYQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCAISLVFS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC45A3 Blocking Peptide, (ABIN940344), is also available for use as a blocking control in assays to test for specificity of this SLC45A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC45A3

Target: SLC45A3 (Solute Carrier Family 45, Member 3 (SLC45A3))

Andere Bezeichnung: SLC45A3

Hintergrund: SLC45A3 is a multi-pass membrane protein. It belongs to the glycoside-pentoside-hexuronide (GPH) cation symporter transporter family. It is a marker for prostate cells. It may be used, in case of prostate cancers, as a target antigen for protate carcinomas-directed cytotoxic T-cell lymphocytes.

Molekulargewicht: 59 kDa (MW of target protein)