SLC45A3 Antikörper (Middle Region)

Produktnummer ABIN635719

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch SLC45A3 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für SLC45A3 Antikörper (Middle Region) (ABIN635719)

Target: SLC45A3 (Solute Carrier Family 45, Member 3 (SLC45A3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC45A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC45A3 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SLC45 A3 antibody was raised against the middle region of SLC45 3

Aufreinigung: Affinity purified

Immunogen: SLC45 A3 antibody was raised using the middle region of SLC45 3 corresponding to a region with amino acids LFYTDFVGEGLYQGVPRAEPGTEARRHYDEGVRMGSLGLFLQCAISLVFS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC45A3 Blocking Peptide, (ABIN940344), is also available for use as a blocking control in assays to test for specificity of this SLC45A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC45A3

Target: SLC45A3 (Solute Carrier Family 45, Member 3 (SLC45A3))

Andere Bezeichnung: SLC45A3

Hintergrund: SLC45A3 is a multi-pass membrane protein. It belongs to the glycoside-pentoside-hexuronide (GPH) cation symporter transporter family. It is a marker for prostate cells. It may be used, in case of prostate cancers, as a target antigen for protate carcinomas-directed cytotoxic T-cell lymphocytes.

Molekulargewicht: 59 kDa (MW of target protein)