Netrin 4 Antikörper (N-Term)

Produktnummer ABIN635714

Produktdetails anti-Netrin 4 Antikörper

Target: Netrin 4 (NTN4)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Netrin 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Netrin 4 antibody was raised against the N terminal of NTN4

Aufreinigung: Affinity purified

Immunogen: Netrin 4 antibody was raised using the N terminal of NTN4 corresponding to a region with amino acids EDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Netrin 4 Blocking Peptide, catalog no. 33R-2330, is also available for use as a blocking control in assays to test for specificity of this Netrin 4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NTN4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Netrin 4

Target: Netrin 4 (NTN4)

Andere Bezeichnung: Netrin 4 (NTN4 Produkte)

Synonyme: Netrin-4 antikoerper, PRO3091 antikoerper, RGD1565947 antikoerper, netrin 4 antikoerper, netrin-4 antikoerper, NTN4 antikoerper, ntn4 antikoerper, Ntn4 antikoerper, LOC100541214 antikoerper

Hintergrund: NTN4 contains 3 laminin EGF-like domains, 1 laminin N-terminal domain and 1 NTR domain. NTN4 may play an important role in neural, kidney and vascular development. It promotes neurite elongation from olfactory bulb explants.

Molekulargewicht: 70 kDa (MW of target protein)