Netrin 4 Antikörper (N-Term)

Produktnummer ABIN635714

Der Kaninchen Polyklonal Anti-Netrin 4-Antikörper wurde für WB validiert. Er ist geeignet, Netrin 4 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für Netrin 4 Antikörper (N-Term) (ABIN635714)

Target: Netrin 4 (NTN4)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Netrin 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Netrin 4 Antikörper

Bindungsspezifität: N-Term

Spezifität: Netrin 4 antibody was raised against the N terminal of NTN4

Aufreinigung: Affinity purified

Immunogen: Netrin 4 antibody was raised using the N terminal of NTN4 corresponding to a region with amino acids EDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Netrin 4 Blocking Peptide, (ABIN937716), is also available for use as a blocking control in assays to test for specificity of this Netrin 4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NTN4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Netrin 4

Target: Netrin 4 (NTN4)

Andere Bezeichnung: Netrin 4

Hintergrund: NTN4 contains 3 laminin EGF-like domains, 1 laminin N-terminal domain and 1 NTR domain. NTN4 may play an important role in neural, kidney and vascular development. It promotes neurite elongation from olfactory bulb explants.

Molekulargewicht: 70 kDa (MW of target protein)