MTCH1 Antikörper

Produktnummer ABIN635711

Der Kaninchen Polyklonal Anti-MTCH1-Antikörper wurde für WB validiert. Er ist geeignet, MTCH1 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für MTCH1 Antikörper (ABIN635711)

Target: MTCH1 (Mitochondrial Carrier 1 (MTCH1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MTCH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MTCH1 Antikörper

Aufreinigung: Affinity purified

Immunogen: MTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NNCGLQAGLPPYSPVFKSWIHCWKYLSVQGQLFRGSSLLFRRVSSGSCFA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MTCH1 Blocking Peptide, (ABIN5614860), is also available for use as a blocking control in assays to test for specificity of this MTCH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTCH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MTCH1

Target: MTCH1 (Mitochondrial Carrier 1 (MTCH1))

Andere Bezeichnung: MTCH1

Hintergrund: MTCH1 is a potential mitochondrial transporter. It may play a role in apoptosis.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity, SARS-CoV-2 Protein Interaktom