SEMA4B Antikörper (N-Term)
-
- Target Alle SEMA4B Antikörper anzeigen
- SEMA4B (Sema Domain, Immunoglobulin Domain (Ig), Transmembrane Domain (TM) and Short Cytoplasmic Domain, (Semaphorin) 4B (SEMA4B))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SEMA4B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SEMA4 B antibody was raised against the N terminal of SEMA4
- Aufreinigung
- Affinity purified
- Immunogen
- SEMA4 B antibody was raised using the N terminal of SEMA4 corresponding to a region with amino acids KGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESS
- Top Product
- Discover our top product SEMA4B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SEMA4B Blocking Peptide, catalog no. 33R-4404, is also available for use as a blocking control in assays to test for specificity of this SEMA4B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMA0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SEMA4B (Sema Domain, Immunoglobulin Domain (Ig), Transmembrane Domain (TM) and Short Cytoplasmic Domain, (Semaphorin) 4B (SEMA4B))
- Andere Bezeichnung
- SEMA4B (SEMA4B Produkte)
- Synonyme
- sema4b antikoerper, MGC80974 antikoerper, SEMA4B antikoerper, SEMAC antikoerper, SemC antikoerper, Semac antikoerper, mKIAA1745 antikoerper, semaphorin 4B antikoerper, semaphorin 4B S homeolog antikoerper, sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4B antikoerper, SEMA4B antikoerper, sema4b.S antikoerper, Sema4b antikoerper
- Hintergrund
- SEMA4B is a single-pass type I membrane protein. It belongs to the semaphorin family. SEMA4B contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 PSI domain and 1 Sema domain. It inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons.
- Molekulargewicht
- 93 kDa (MW of target protein)
-