SEMA4B Antikörper (N-Term)

Produktnummer ABIN635702

Der Kaninchen Polyklonal anti-SEMA4B Antikörper wird verwendet zum Nachweis von SEMA4B in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für SEMA4B Antikörper (N-Term) (ABIN635702)

Target: SEMA4B (Sema Domain, Immunoglobulin Domain (Ig), Transmembrane Domain (TM) and Short Cytoplasmic Domain, (Semaphorin) 4B (SEMA4B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SEMA4B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SEMA4B Antikörper

Bindungsspezifität: N-Term

Spezifität: SEMA4 B antibody was raised against the N terminal of SEMA4

Aufreinigung: Affinity purified

Immunogen: SEMA4 B antibody was raised using the N terminal of SEMA4 corresponding to a region with amino acids KGRCPFDPNFKSTALVVDGELYTGTVSSFQGNDPAISRSQSLRPTKTESS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SEMA4B Blocking Peptide, (ABIN939790), is also available for use as a blocking control in assays to test for specificity of this SEMA4B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMA0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SEMA4B

Target: SEMA4B (Sema Domain, Immunoglobulin Domain (Ig), Transmembrane Domain (TM) and Short Cytoplasmic Domain, (Semaphorin) 4B (SEMA4B))

Andere Bezeichnung: SEMA4B

Hintergrund: SEMA4B is a single-pass type I membrane protein. It belongs to the semaphorin family. SEMA4B contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 PSI domain and 1 Sema domain. It inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons.

Molekulargewicht: 93 kDa (MW of target protein)