ALDH3A2 Antikörper (C-Term)

Produktnummer ABIN635691

Dieses Anti-ALDH3A2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ALDH3A2 in WB und IHC. Geeignet für Human, Ratte und Maus.

Kurzübersicht für ALDH3A2 Antikörper (C-Term) (ABIN635691)

Target: ALDH3A2 (Aldehyde Dehydrogenase 3 Family, Member A2 (ALDH3A2))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALDH3A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-ALDH3A2 Antikörper

Bindungsspezifität: C-Term

Spezifität: ALDH3 A2 antibody was raised against the C terminal of ALDH3 2

Aufreinigung: Affinity purified

Immunogen: ALDH3 A2 antibody was raised using the C terminal of ALDH3 2 corresponding to a region with amino acids FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALDH3A2 Blocking Peptide, (ABIN938319), is also available for use as a blocking control in assays to test for specificity of this ALDH3A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALDH3A2

Target: ALDH3A2 (Aldehyde Dehydrogenase 3 Family, Member A2 (ALDH3A2))

Andere Bezeichnung: ALDH3A2

Hintergrund: Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This gene product catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acid. Mutations in the gene cause Sjogren-Larsson syndrome.

Molekulargewicht: 53 kDa (MW of target protein)