TMED4 Antikörper (Middle Region)

Produktnummer ABIN635682

Produktdetails anti-TMED4 Antikörper

Target: TMED4 (Transmembrane Emp24 Protein Transport Domain Containing 4 (TMED4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMED4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMED4 antibody was raised against the middle region of TMED4

Aufreinigung: Affinity purified

Immunogen: TMED4 antibody was raised using the middle region of TMED4 corresponding to a region with amino acids DIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREER

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMED4 Blocking Peptide, catalog no. 33R-2004, is also available for use as a blocking control in assays to test for specificity of this TMED4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMED4

Target: TMED4 (Transmembrane Emp24 Protein Transport Domain Containing 4 (TMED4))

Andere Bezeichnung: TMED4 (TMED4 Produkte)

Synonyme: TMED4 antikoerper, ERS25 antikoerper, HNLF antikoerper, 1110014L17Rik antikoerper, AI326346 antikoerper, fc88h09 antikoerper, wu:fc88h09 antikoerper, zgc:86755 antikoerper, ers25 antikoerper, hnlf antikoerper, RGD1306319 antikoerper, transmembrane p24 trafficking protein 4 antikoerper, transmembrane p24 trafficking protein 4 S homeolog antikoerper, TMED4 antikoerper, Tmed4 antikoerper, tmed4 antikoerper, tmed4.S antikoerper

Hintergrund: TMED4 contains 1 GOLD domain and belongs to the EMP24/GP25L family. The function remains unknown.

Molekulargewicht: 26 kDa (MW of target protein)