TMEM63B Antikörper (Middle Region)

Produktnummer ABIN635674

Produktdetails anti-TMEM63B Antikörper

Target: TMEM63B (Transmembrane Protein 63B (TMEM63B))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM63B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM63 B antibody was raised against the middle region of TMEM63

Aufreinigung: Affinity purified

Immunogen: TMEM63 B antibody was raised using the middle region of TMEM63 corresponding to a region with amino acids VRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM63B Blocking Peptide, catalog no. 33R-9772, is also available for use as a blocking control in assays to test for specificity of this TMEM63B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM60 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM63B

Target: TMEM63B (Transmembrane Protein 63B (TMEM63B))

Andere Bezeichnung: TMEM63B (TMEM63B Produkte)

Synonyme: C6orf110 antikoerper, RP3-421H19.2 antikoerper, BC026370 antikoerper, RGD1305862 antikoerper, Tmem63b-ps1 antikoerper, transmembrane protein 63B antikoerper, transmembrane protein 63b antikoerper, TMEM63B antikoerper, Tmem63b antikoerper

Hintergrund: TMEM63B belongs to the SPO75/TMEM63 family. It is a multi-pass membrane protein. The function of TMEM63B remains unknown.

Molekulargewicht: 95 kDa (MW of target protein)