IGHV5-2 Antikörper (N-Term)
-
- Target
- IGHV5-2 (Immunoglobulin Heavy Variable 5-2 (IGHV5-2))
- Bindungsspezifität
- N-Term
- Reaktivität
- Human
- Wirt
- Kaninchen
- Klonalität
- Polyklonal
- Applikation
- Western Blotting (WB)
- Spezifität
- PIGZ antibody was raised against the N terminal of PIGZ
- Aufreinigung
- Affinity purified
- Immunogen
- PIGZ antibody was raised using the N terminal of PIGZ corresponding to a region with amino acids VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PIGZ Blocking Peptide, catalog no. 33R-9694, is also available for use as a blocking control in assays to test for specificity of this PIGZ antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGZ antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IGHV5-2 (Immunoglobulin Heavy Variable 5-2 (IGHV5-2))
- Andere Bezeichnung
- IGZ
- Hintergrund
- The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. PIGZ is a protein that is localized to the endoplasmic reticulum, and is involved in GPI anchor biosynthesis. As shown for the yeast homolog, which is a member of a family of dolichol-phosphate-mannose (Dol-P-Man)-dependent mannosyltransferases, this protein can also add a side-branching fourth mannose to GPI precursors during the assembly of GPI anchors.
- Molekulargewicht
- 63 kDa (MW of target protein)
-