IGHV5-2 Antikörper (N-Term)

Produktnummer ABIN635673

Dieser Anti-IGHV5-2-Antikörper ist ein Kaninchen-Polyklonal-Antikörper zum Nachweis von IGHV5-2 in WB. Geeignet für Human.

Kurzübersicht für IGHV5-2 Antikörper (N-Term) (ABIN635673)

Target: IGHV5-2 (Immunoglobulin Heavy Variable 5-2 (IGHV5-2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Applikation: Western Blotting (WB)

Produktdetails anti-IGHV5-2 Antikörper

Bindungsspezifität: N-Term

Spezifität: PIGZ antibody was raised against the N terminal of PIGZ

Aufreinigung: Affinity purified

Immunogen: PIGZ antibody was raised using the N terminal of PIGZ corresponding to a region with amino acids VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIGZ Blocking Peptide, (ABIN5615374), is also available for use as a blocking control in assays to test for specificity of this PIGZ antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGZ antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IGHV5-2

Target: IGHV5-2 (Immunoglobulin Heavy Variable 5-2 (IGHV5-2))

Andere Bezeichnung: IGZ

Hintergrund: The glycosylphosphatidylinositol (GPI) anchor is a glycolipid found on many blood cells that serves to anchor proteins to the cell surface. PIGZ is a protein that is localized to the endoplasmic reticulum, and is involved in GPI anchor biosynthesis. As shown for the yeast homolog, which is a member of a family of dolichol-phosphate-mannose (Dol-P-Man)-dependent mannosyltransferases, this protein can also add a side-branching fourth mannose to GPI precursors during the assembly of GPI anchors.

Molekulargewicht: 63 kDa (MW of target protein)