TMEM63A Antikörper (N-Term)

Produktnummer ABIN635671

Produktdetails anti-TMEM63A Antikörper

Target: TMEM63A (Transmembrane Protein 63A (TMEM63A))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM63A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM63 A antibody was raised against the N terminal of TMEM63

Aufreinigung: Affinity purified

Immunogen: TMEM63 A antibody was raised using the N terminal of TMEM63 corresponding to a region with amino acids MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM63A Blocking Peptide, catalog no. 33R-5872, is also available for use as a blocking control in assays to test for specificity of this TMEM63A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM60 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM63A

Target: TMEM63A (Transmembrane Protein 63A (TMEM63A))

Andere Bezeichnung: TMEM63A (TMEM63A Produkte)

Synonyme: si:ch211-117l16.1 antikoerper, KIAA0792 antikoerper, BC014795 antikoerper, Tmem64a antikoerper, RGD1306829 antikoerper, Tmem6 antikoerper, transmembrane protein 63A antikoerper, transmembrane protein 63a antikoerper, tmem63a antikoerper, CpipJ_CPIJ011090 antikoerper, TMEM63A antikoerper, Tmem63a antikoerper

Hintergrund: TMEM63A is a multi-pass membrane proteinPotential. It belongs to the SPO75/TMEM63 family. The exact function of TMEM63A remains unknown.

Molekulargewicht: 89 kDa (MW of target protein)