TMEM63A Antikörper (N-Term)

Produktnummer ABIN635671

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TMEM63A in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für TMEM63A Antikörper (N-Term) (ABIN635671)

Target: TMEM63A (Transmembrane Protein 63A (TMEM63A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM63A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMEM63A Antikörper

Bindungsspezifität: N-Term

Spezifität: TMEM63 A antibody was raised against the N terminal of TMEM63

Aufreinigung: Affinity purified

Immunogen: TMEM63 A antibody was raised using the N terminal of TMEM63 corresponding to a region with amino acids MDSPFLELWQSKAVSIREQLGLGDRPNDSYCYNSAKNSTVLQGVTFGGIP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM63A Blocking Peptide, (ABIN5616685), is also available for use as a blocking control in assays to test for specificity of this TMEM63A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM60 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM63A

Target: TMEM63A (Transmembrane Protein 63A (TMEM63A))

Andere Bezeichnung: TMEM63A

Hintergrund: TMEM63A is a multi-pass membrane proteinPotential. It belongs to the SPO75/TMEM63 family. The exact function of TMEM63A remains unknown.

Molekulargewicht: 89 kDa (MW of target protein)