ATP5G2 Antikörper

Produktnummer ABIN635670

Dieses Anti-ATP5G2-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von ATP5G2 in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für ATP5G2 Antikörper (ABIN635670)

Target: ATP5G2 (ATP Synthase, H+ Transporting, Mitochondrial Fo Complex, Subunit C2 (Subunit 9) (ATP5G2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP5G2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-ATP5G2 Antikörper

Aufreinigung: Affinity purified

Immunogen: ATP5 G2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQTSAISRDIDTA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATP5G2 Blocking Peptide, (ABIN5612227), is also available for use as a blocking control in assays to test for specificity of this ATP5G2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP5G2

Target: ATP5G2 (ATP Synthase, H+ Transporting, Mitochondrial Fo Complex, Subunit C2 (Subunit 9) (ATP5G2))

Andere Bezeichnung: ATP5G2

Hintergrund: ATP5G2 is a subunit of mitochondrial ATP synthase.

Molekulargewicht: 8 kDa (MW of target protein)

Pathways: Proton Transport, Ribonucleoside Biosynthetic Process