EPSTI1 Antikörper

Produktnummer ABIN635669

Der Kaninchen Polyklonal Anti-EPSTI1-Antikörper wurde für WB validiert. Er ist geeignet, EPSTI1 in Proben von Human zu detektieren.

Kurzübersicht für EPSTI1 Antikörper (ABIN635669)

Target: EPSTI1 (Epithelial Stromal Interaction 1 (Breast) (EPSTI1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EPSTI1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-EPSTI1 Antikörper

Aufreinigung: Affinity purified

Immunogen: EPSTI1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EPSTI1 Blocking Peptide, (ABIN5613390), is also available for use as a blocking control in assays to test for specificity of this EPSTI1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPSTI1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EPSTI1

Target: EPSTI1 (Epithelial Stromal Interaction 1 (Breast) (EPSTI1))

Andere Bezeichnung: EPSTI1

Hintergrund: EPSTI1 was up-regulated in breast carcinomas. The exact function of EPSTI1 is not known.

Molekulargewicht: 47 kDa (MW of target protein)