HSD3B1 Antikörper (N-Term)

Produktnummer ABIN635665

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch HSD3B1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für HSD3B1 Antikörper (N-Term) (ABIN635665)

Target: HSD3B1 (Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 1 (HSD3B1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HSD3B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HSD3B1 Antikörper

Bindungsspezifität: N-Term

Spezifität: HSD3 B1 antibody was raised against the N terminal of HSD3 1

Aufreinigung: Affinity purified

Immunogen: HSD3 B1 antibody was raised using the N terminal of HSD3 1 corresponding to a region with amino acids TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HSD3B1 Blocking Peptide, (ABIN5614080), is also available for use as a blocking control in assays to test for specificity of this HSD3B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HSD3B1

Target: HSD3B1 (Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 1 (HSD3B1))

Andere Bezeichnung: HSD3B1

Hintergrund: 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis, C21-Steroid Hormone Metabolic Process, Carbohydrate Homeostasis