SUSD3 Antikörper (N-Term)

Produktnummer ABIN635664

Dieses Anti-SUSD3-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SUSD3 in WB. Geeignet für Human.

Kurzübersicht für SUSD3 Antikörper (N-Term) (ABIN635664)

Target: SUSD3 (Sushi Domain Containing 3 (SUSD3))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SUSD3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SUSD3 Antikörper

Bindungsspezifität: N-Term

Spezifität: SUSD3 antibody was raised against the N terminal of SUSD3

Aufreinigung: Affinity purified

Immunogen: SUSD3 antibody was raised using the N terminal of SUSD3 corresponding to a region with amino acids LRLPPQATFQVLRGNGASVGTVLMFRCPSNHQMVGSGLLTCTWKGSIAEW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SUSD3 Blocking Peptide, catalog no. 33R-5371, is also available for use as a blocking control in assays to test for specificity of this SUSD3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUSD3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SUSD3

Target: SUSD3 (Sushi Domain Containing 3 (SUSD3))

Andere Bezeichnung: SUSD3

Hintergrund: The function of SUSD3 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 27 kDa (MW of target protein)