P4HTM Antikörper (Middle Region)
-
- Target Alle P4HTM Antikörper anzeigen
- P4HTM (Prolyl 4-Hydroxylase, Transmembrane (Endoplasmic Reticulum) (P4HTM))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser P4HTM Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PH4 antibody was raised against the middle region of PH-4
- Aufreinigung
- Affinity purified
- Immunogen
- PH4 antibody was raised using the middle region of PH-4 corresponding to a region with amino acids RLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSH
- Top Product
- Discover our top product P4HTM Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PH4 Blocking Peptide, catalog no. 33R-8025, is also available for use as a blocking control in assays to test for specificity of this PH4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PH-4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- P4HTM (Prolyl 4-Hydroxylase, Transmembrane (Endoplasmic Reticulum) (P4HTM))
- Andere Bezeichnung
- PH4 (P4HTM Produkte)
- Synonyme
- Ph-4 antikoerper, RGD1311848 antikoerper, EGLN4 antikoerper, HIFPH4 antikoerper, P4H-TM antikoerper, PH-4 antikoerper, PH4 antikoerper, PHD4 antikoerper, 4933406E20Rik antikoerper, AI853847 antikoerper, BB128974 antikoerper, prolyl 4-hydroxylase, transmembrane antikoerper, prolyl 4-hydroxylase, transmembrane (endoplasmic reticulum) antikoerper, shisa family member 5 antikoerper, P4htm antikoerper, P4HTM antikoerper, SHISA5 antikoerper
- Hintergrund
- The product of this gene belongs to the family of prolyl 4-hydroxylases. This protein is a prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia.
- Molekulargewicht
- 57 kDa (MW of target protein)
-