P4HTM Antikörper (Middle Region)

Produktnummer ABIN635661

Produktdetails anti-P4HTM Antikörper

Target: P4HTM (Prolyl 4-Hydroxylase, Transmembrane (Endoplasmic Reticulum) (P4HTM))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser P4HTM Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PH4 antibody was raised against the middle region of PH-4

Aufreinigung: Affinity purified

Immunogen: PH4 antibody was raised using the middle region of PH-4 corresponding to a region with amino acids RLGNGWWMTPESIQEMYAAIKADPDGDGVLSLQEFSNMDLRDFHKYMRSH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PH4 Blocking Peptide, catalog no. 33R-8025, is also available for use as a blocking control in assays to test for specificity of this PH4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PH-4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu P4HTM

Target: P4HTM (Prolyl 4-Hydroxylase, Transmembrane (Endoplasmic Reticulum) (P4HTM))

Andere Bezeichnung: PH4 (P4HTM Produkte)

Synonyme: Ph-4 antikoerper, RGD1311848 antikoerper, EGLN4 antikoerper, HIFPH4 antikoerper, P4H-TM antikoerper, PH-4 antikoerper, PH4 antikoerper, PHD4 antikoerper, 4933406E20Rik antikoerper, AI853847 antikoerper, BB128974 antikoerper, prolyl 4-hydroxylase, transmembrane antikoerper, prolyl 4-hydroxylase, transmembrane (endoplasmic reticulum) antikoerper, shisa family member 5 antikoerper, P4htm antikoerper, P4HTM antikoerper, SHISA5 antikoerper

Hintergrund: The product of this gene belongs to the family of prolyl 4-hydroxylases. This protein is a prolyl hydroxylase that may be involved in the degradation of hypoxia-inducible transcription factors under normoxia.

Molekulargewicht: 57 kDa (MW of target protein)