Pannexin 3 Antikörper (Middle Region)

Produktnummer ABIN635645

Produktdetails anti-Pannexin 3 Antikörper

Target: Pannexin 3 (PANX3)

Bindungsspezifität: Middle Region

Reaktivität: Säugetier

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Pannexin 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Pannexin 3 antibody was raised against the middle region of PANX3

Kreuzreaktivität: Human, Maus, Ratte (Rattus)

Aufreinigung: Affinity purified

Immunogen: Pannexin 3 antibody was raised using the middle region of PANX3 corresponding to a region with amino acids IISELDKSYNRSIRLVQHMLKIRQKSSDPYVFWNELEKARKERYFEFPLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Pannexin 3 Blocking Peptide, catalog no. 33R-4008, is also available for use as a blocking control in assays to test for specificity of this Pannexin 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PANX3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Pannexin 3

Target: Pannexin 3 (PANX3)

Andere Bezeichnung: Pannexin 3 (PANX3 Produkte)

Synonyme: PX3 antikoerper, 3230401P04 antikoerper, 4833413G11Rik antikoerper, pannexin 3 antikoerper, PANX3 antikoerper, LOC100533355 antikoerper, Panx3 antikoerper

Hintergrund: The protein encoded by this gene belongs to the innexin family. Innexin family members are known to be the structural components of gap junctions.

Molekulargewicht: 45 kDa (MW of target protein)