Surfactant Protein C Antikörper (N-Term)

Produktnummer ABIN635635

Produktdetails anti-Surfactant Protein C Antikörper

Target: Surfactant Protein C (SFTPC)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Surfactant Protein C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SFTPC antibody was raised against the N terminal of SFTPC

Aufreinigung: Affinity purified

Immunogen: SFTPC antibody was raised using the N terminal of SFTPC corresponding to a region with amino acids MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SFTPC Blocking Peptide, catalog no. 33R-5881, is also available for use as a blocking control in assays to test for specificity of this SFTPC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFTPC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Surfactant Protein C

Target: Surfactant Protein C (SFTPC)

Andere Bezeichnung: SFTPC (SFTPC Produkte)

Synonyme: SFTPC antikoerper, SPC antikoerper, SP-C antikoerper, psp-c antikoerper, sftp2 antikoerper, xSP-C antikoerper, Bricd6 antikoerper, SP5 antikoerper, Sftp-2 antikoerper, Sftp2 antikoerper, pro-SpC antikoerper, BRICD6 antikoerper, PSP-C antikoerper, SFTP2 antikoerper, SMDP2 antikoerper, surfactant protein C antikoerper, surfactant, pulmonary-associated protein C S homeolog antikoerper, surfactant, pulmonary-associated protein C antikoerper, surfactant associated protein C antikoerper, SFTPC antikoerper, sftpc.S antikoerper, sftpc antikoerper, Sftpc antikoerper

Hintergrund: This gene encodes the pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids.

Molekulargewicht: 21 kDa (MW of target protein)