SAMD8 Antikörper (Middle Region)

Produktnummer ABIN635629

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SAMD8 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für SAMD8 Antikörper (Middle Region) (ABIN635629)

Target: SAMD8 (Sterile alpha Motif Domain Containing 8 (SAMD8))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SAMD8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SAMD8 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SAMD8 antibody was raised against the middle region of SAMD8

Aufreinigung: Affinity purified

Immunogen: SAMD8 antibody was raised using the middle region of SAMD8 corresponding to a region with amino acids MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SAMD8 Blocking Peptide, (ABIN5615996), is also available for use as a blocking control in assays to test for specificity of this SAMD8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAMD8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SAMD8

Target: SAMD8 (Sterile alpha Motif Domain Containing 8 (SAMD8))

Andere Bezeichnung: SAMD8

Hintergrund: SAMD8 is a multi-pass membrane protein. It belongs to the sphingomyelin synthase family and contains 1 SAM (sterile alpha motif) domain. The function of the SAMD8 protein remains unknown.

Molekulargewicht: 36 kDa (MW of target protein)