SAMD8 Antikörper (Middle Region)

Produktnummer ABIN635629

Produktdetails anti-SAMD8 Antikörper

Target: SAMD8 (Sterile alpha Motif Domain Containing 8 (SAMD8))

Bindungsspezifität: Middle Region

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SAMD8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SAMD8 antibody was raised against the middle region of SAMD8

Aufreinigung: Affinity purified

Immunogen: SAMD8 antibody was raised using the middle region of SAMD8 corresponding to a region with amino acids MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SAMD8 Blocking Peptide, catalog no. 33R-6349, is also available for use as a blocking control in assays to test for specificity of this SAMD8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAMD8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SAMD8

Target: SAMD8 (Sterile alpha Motif Domain Containing 8 (SAMD8))

Andere Bezeichnung: SAMD8 (SAMD8 Produkte)

Synonyme: CG32380 antikoerper, CG8572 antikoerper, CG8576 antikoerper, Css3beta antikoerper, Dmel\\CG32380 antikoerper, dSMSr antikoerper, dmSMSr antikoerper, SMSr antikoerper, 1110053F04Rik antikoerper, 1700010P07Rik antikoerper, CG32380 gene product from transcript CG32380-RA antikoerper, sterile alpha motif domain containing 8 antikoerper, SMSr antikoerper, SAMD8 antikoerper, samd8 antikoerper, Samd8 antikoerper

Hintergrund: SAMD8 is a multi-pass membrane protein. It belongs to the sphingomyelin synthase family and contains 1 SAM (sterile alpha motif) domain. The function of the SAMD8 protein remains unknown.

Molekulargewicht: 36 kDa (MW of target protein)