TRAM1L1 Antikörper (Middle Region)

Produktnummer ABIN635623

Produktdetails anti-TRAM1L1 Antikörper

Target: TRAM1L1 (Translocation Associated Membrane Protein 1-Like 1 (TRAM1L1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TRAM1L1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TRAM1 L1 antibody was raised against the middle region of TRAM1 1

Aufreinigung: Affinity purified

Immunogen: TRAM1 L1 antibody was raised using the middle region of TRAM1 1 corresponding to a region with amino acids LWAIVFILGRLVTLIVSVLTVGFHLAGSQNRNPDALTGNVNVLAAKIAVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TRAM1L1 Blocking Peptide, catalog no. 33R-5552, is also available for use as a blocking control in assays to test for specificity of this TRAM1L1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAM0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TRAM1L1

Target: TRAM1L1 (Translocation Associated Membrane Protein 1-Like 1 (TRAM1L1))

Andere Bezeichnung: TRAM1L1 (TRAM1L1 Produkte)

Synonyme: A830091N21Rik antikoerper, translocation associated membrane protein 1-like 1 antikoerper, TRAM1L1 antikoerper, Tram1l1 antikoerper

Hintergrund: TRAM1L1 is stimulatory or required for the translocation of secretory proteins across the ER membrane.

Molekulargewicht: 42 kDa (MW of target protein)