TRAM1L1 Antikörper (Middle Region)
-
- Target Alle TRAM1L1 Antikörper anzeigen
- TRAM1L1 (Translocation Associated Membrane Protein 1-Like 1 (TRAM1L1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRAM1L1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TRAM1 L1 antibody was raised against the middle region of TRAM1 1
- Aufreinigung
- Affinity purified
- Immunogen
- TRAM1 L1 antibody was raised using the middle region of TRAM1 1 corresponding to a region with amino acids LWAIVFILGRLVTLIVSVLTVGFHLAGSQNRNPDALTGNVNVLAAKIAVL
- Top Product
- Discover our top product TRAM1L1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TRAM1L1 Blocking Peptide, catalog no. 33R-5552, is also available for use as a blocking control in assays to test for specificity of this TRAM1L1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRAM0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRAM1L1 (Translocation Associated Membrane Protein 1-Like 1 (TRAM1L1))
- Andere Bezeichnung
- TRAM1L1 (TRAM1L1 Produkte)
- Hintergrund
- TRAM1L1 is stimulatory or required for the translocation of secretory proteins across the ER membrane.
- Molekulargewicht
- 42 kDa (MW of target protein)
-