SIDT2 Antikörper (N-Term)

Produktnummer ABIN635622

Der Kaninchen Polyklonal anti-SIDT2 Antikörper (ABIN635622) detektiert spezifisch SIDT2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für SIDT2 Antikörper (N-Term) (ABIN635622)

Target: SIDT2 (SID1 Transmembrane Family, Member 2 (SIDT2))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SIDT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SIDT2 Antikörper

Bindungsspezifität: N-Term

Spezifität: SIDT2 antibody was raised against the N terminal of SIDT2

Aufreinigung: Affinity purified

Immunogen: SIDT2 antibody was raised using the N terminal of SIDT2 corresponding to a region with amino acids LNKQKGAPLLFVVRQKEAVVSFQVPLILRGMFQRKYLYQKVERTLCQPPT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SIDT2 Blocking Peptide, (ABIN5616142), is also available for use as a blocking control in assays to test for specificity of this SIDT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIDT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SIDT2

Target: SIDT2 (SID1 Transmembrane Family, Member 2 (SIDT2))

Andere Bezeichnung: SIDT2

Hintergrund: SIDT2 belongs to the SID1 family. It is a multi-pass membrane protein. The exact function of SIDT2 remains unknown.

Molekulargewicht: 94 kDa (MW of target protein)