YIPF6 Antikörper (C-Term)

Produktnummer ABIN635621

Produktdetails anti-YIPF6 Antikörper

Target: YIPF6 (Yip1 Domain Family, Member 6 (YIPF6))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser YIPF6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: YIPF6 antibody was raised against the C terminal of YIPF6

Aufreinigung: Affinity purified

Immunogen: YIPF6 antibody was raised using the C terminal of YIPF6 corresponding to a region with amino acids MVRLFVVIVMFAWSIVASTALLADSQPPNRRALAVYPVFLFYFVISWMIL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

YIPF6 Blocking Peptide, catalog no. 33R-6602, is also available for use as a blocking control in assays to test for specificity of this YIPF6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YIPF6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu YIPF6

Target: YIPF6 (Yip1 Domain Family, Member 6 (YIPF6))

Andere Bezeichnung: YIPF6 (YIPF6 Produkte)

Synonyme: DDBDRAFT_0204973 antikoerper, DDBDRAFT_0233687 antikoerper, DDB_0204973 antikoerper, DDB_0233687 antikoerper, zgc:86904 antikoerper, FinGER6 antikoerper, A430107J06Rik antikoerper, Yip1 domain family member 6 antikoerper, Yipf6 protein antikoerper, protein YIPF6 antikoerper, Yip1 domain-containing protein antikoerper, YIPF6-like protein antikoerper, YIPF6 antikoerper, protein YIPF6-like antikoerper, Yip1 domain family, member 6 antikoerper, Yip1 domain family member 6 L homeolog antikoerper, YIPF6 antikoerper, yipf6 antikoerper, Yipf6 antikoerper, EDI_154100 antikoerper, PITG_00974 antikoerper, VDBG_00769 antikoerper, LOC100366793 antikoerper, yipf6.L antikoerper

Hintergrund: YIPF6 is a multi-pass membrane proteinPotential. It belongs to the YIP1 family. The exact function of YIPF6 remains unknown.

Molekulargewicht: 26 kDa (MW of target protein)