SLC26A4 Antikörper (Middle Region)

Produktnummer ABIN635614

Produktdetails anti-SLC26A4 Antikörper

Target: SLC26A4 (Solute Carrier Family 26, Member 4 (SLC26A4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC26A4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC26 A4 antibody was raised against the middle region of SLC26 4

Aufreinigung: Affinity purified

Immunogen: SLC26 A4 antibody was raised using the middle region of SLC26 4 corresponding to a region with amino acids ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC26A4 Blocking Peptide, catalog no. 33R-2563, is also available for use as a blocking control in assays to test for specificity of this SLC26A4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC26A4

Target: SLC26A4 (Solute Carrier Family 26, Member 4 (SLC26A4))

Andere Bezeichnung: SLC26A4 (SLC26A4 Produkte)

Synonyme: Pds antikoerper, DFNB4 antikoerper, EVA antikoerper, PDS antikoerper, TDH2B antikoerper, pendrin antikoerper, solute carrier family 26 member 4 antikoerper, solute carrier family 26, member 4 antikoerper, SLC26A4 antikoerper, Slc26a4 antikoerper

Hintergrund: Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene.

Molekulargewicht: 86 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, Sensory Perception of Sound