SLC26A4 Antikörper (Middle Region)

Produktnummer ABIN635614

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch SLC26A4 in WB. Er zeigt eine Reaktivität gegenüber Human und Maus.

Kurzübersicht für SLC26A4 Antikörper (Middle Region) (ABIN635614)

Target: SLC26A4 (Solute Carrier Family 26, Member 4 (SLC26A4))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC26A4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC26A4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SLC26 A4 antibody was raised against the middle region of SLC26 4

Aufreinigung: Affinity purified

Immunogen: SLC26 A4 antibody was raised using the middle region of SLC26 4 corresponding to a region with amino acids ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC26A4 Blocking Peptide, (ABIN937949), is also available for use as a blocking control in assays to test for specificity of this SLC26A4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC26A4

Target: SLC26A4 (Solute Carrier Family 26, Member 4 (SLC26A4))

Andere Bezeichnung: SLC26A4

Hintergrund: Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene.

Molekulargewicht: 86 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, Sensory Perception of Sound