SLC38A3 Antikörper (N-Term)

Produktnummer ABIN635610

Dieses Anti-SLC38A3-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SLC38A3 in WB. Geeignet für Human und Maus.

Kurzübersicht für SLC38A3 Antikörper (N-Term) (ABIN635610)

Target: SLC38A3 (Solute Carrier Family 38 Member 3 (SLC38A3))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC38A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC38A3 Antikörper

Bindungsspezifität: N-Term

Spezifität: SLC38 A3 antibody was raised against the N terminal of SLC38 3

Aufreinigung: Affinity purified

Immunogen: SLC38 A3 antibody was raised using the N terminal of SLC38 3 corresponding to a region with amino acids GNQRVEDPARSCMEGKSFLQKSPSKEPHFTDFEGKTSFGMSVFNLSNAIM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC38A3 Blocking Peptide, (ABIN938842), is also available for use as a blocking control in assays to test for specificity of this SLC38A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC38A3

Target: SLC38A3 (Solute Carrier Family 38 Member 3 (SLC38A3))

Andere Bezeichnung: SLC38A3

Hintergrund: As a sodium-dependent amino acid/proton antiporter, SLC38A3 mediates electrogenic cotransport of glutamine and sodium ions in exchange for protons. It also recognises histidine, asparagine and alanine. It may mediate amino acid transport in either direction under physiological conditions and play a role in nitrogen metabolism and synaptic transmission.

Molekulargewicht: 56 kDa (MW of target protein)