FLJ20489 (C-Term) Antikörper

Produktnummer ABIN635609

Der Kaninchen Polyklonal Anti--Antikörper wurde für IHC und WB validiert. Er ist geeignet, in Proben von Human zu detektieren.

Kurzübersicht für FLJ20489 (C-Term) Antikörper (ABIN635609)

Target: FLJ20489

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Produktdetails

Bindungsspezifität: C-Term

Spezifität: FLJ20489 antibody was raised against the C terminal of FLJ20489

Aufreinigung: Affinity purified

Immunogen: FLJ20489 antibody was raised using the C terminal of FLJ20489 corresponding to a region with amino acids LISGDSPASAFQSAGIIGVSHRARPGSVFLARSEESLYLRPGQQSQEVKV

Anwendungsinformationen

Applikationshinweise: WB: 0.0625 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FLJ20489 Blocking Peptide, (ABIN940449), is also available for use as a blocking control in assays to test for specificity of this FLJ20489 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ20489 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: FLJ20489

Hintergrund: FLJ20489 is a heme transporter that regulates intracellular heme availability through the endosomal or lysosomal compartment.

Molekulargewicht: 26 kDa (MW of target protein)