TMCC2 Antikörper (N-Term)

Produktnummer ABIN635608

Produktdetails anti-TMCC2 Antikörper

Target: TMCC2 (Transmembrane and Coiled-Coil Domain Family 2 (TMCC2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMCC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMCC2 antibody was raised against the N terminal of TMCC2

Aufreinigung: Affinity purified

Immunogen: TMCC2 antibody was raised using the N terminal of TMCC2 corresponding to a region with amino acids GETTGANSAGGPTSDAGAAAAPNPGPRSKPPDLKKIQQLSEGSMFGHGLK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMCC2 Blocking Peptide, catalog no. 33R-3253, is also available for use as a blocking control in assays to test for specificity of this TMCC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMCC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMCC2

Target: TMCC2 (Transmembrane and Coiled-Coil Domain Family 2 (TMCC2))

Andere Bezeichnung: TMCC2 (TMCC2 Produkte)

Synonyme: 1110063G11Rik antikoerper, RGD1311960 antikoerper, HUCEP11 antikoerper, zgc:198155 antikoerper, zgc:198157 antikoerper, transmembrane and coiled-coil domains 2 antikoerper, transmembrane and coiled-coil domain family 2 antikoerper, Tmcc2 antikoerper, TMCC2 antikoerper, TMCO2 antikoerper, tmcc2 antikoerper

Hintergrund: TMCC2 is a multi-pass membrane protein. It belongs to the TEX28 family. The function of TMCC2 remains unknown.

Molekulargewicht: 77 kDa (MW of target protein)