TMEM117 Antikörper (Middle Region)

Produktnummer ABIN635605

Produktdetails anti-TMEM117 Antikörper

Target: TMEM117 (Transmembrane Protein 117 (TMEM117))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM117 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM117 antibody was raised against the middle region of TMEM117

Aufreinigung: Affinity purified

Immunogen: TMEM117 antibody was raised using the middle region of TMEM117 corresponding to a region with amino acids GQYIGPGQKIYTVKDSESLKDLNRTKLSWEWRSNHTNPRTNKTYVEGDMF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM117 Blocking Peptide, catalog no. 33R-3520, is also available for use as a blocking control in assays to test for specificity of this TMEM117 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM117 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM117

Target: TMEM117 (Transmembrane Protein 117 (TMEM117))

Andere Bezeichnung: TMEM117 (TMEM117 Produkte)

Synonyme: wu:fi32b02 antikoerper, zgc:55574 antikoerper, MGC154839 antikoerper, B930062P21Rik antikoerper, RGD1562562 antikoerper, transmembrane protein 117 antikoerper, transmembrane protein 117 S homeolog antikoerper, tmem117 antikoerper, TMEM117 antikoerper, tmem117.S antikoerper, LOC100472537 antikoerper, Tmem117 antikoerper

Hintergrund: TMEM117 is a multi-pass membrane protein. It belongs to the TMEM117 family. The exact function of TMEM117 remains unknown.

Molekulargewicht: 45 kDa (MW of target protein)