TMEM117 Antikörper (Middle Region)

Produktnummer ABIN635605

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch TMEM117 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für TMEM117 Antikörper (Middle Region) (ABIN635605)

Target: TMEM117 (Transmembrane Protein 117 (TMEM117))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM117 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMEM117 Antikörper

Bindungsspezifität: Middle Region

Spezifität: TMEM117 antibody was raised against the middle region of TMEM117

Aufreinigung: Affinity purified

Immunogen: TMEM117 antibody was raised using the middle region of TMEM117 corresponding to a region with amino acids GQYIGPGQKIYTVKDSESLKDLNRTKLSWEWRSNHTNPRTNKTYVEGDMF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM117 Blocking Peptide, (ABIN938906), is also available for use as a blocking control in assays to test for specificity of this TMEM117 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM117 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM117

Target: TMEM117 (Transmembrane Protein 117 (TMEM117))

Andere Bezeichnung: TMEM117

Hintergrund: TMEM117 is a multi-pass membrane protein. It belongs to the TMEM117 family. The exact function of TMEM117 remains unknown.

Molekulargewicht: 45 kDa (MW of target protein)