Cytochrome b Antikörper (N-Term)

Produktnummer ABIN635601

Produktdetails anti-Cytochrome b Antikörper

Target: Cytochrome b (MT-CYB) (Mitochondrially Encoded Cytochrome B (MT-CYB))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cytochrome b Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CYTB antibody was raised against the N terminal of CYTB

Aufreinigung: Affinity purified

Immunogen: CYTB antibody was raised using the N terminal of CYTB corresponding to a region with amino acids TPMRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYTB Blocking Peptide, catalog no. 33R-9225, is also available for use as a blocking control in assays to test for specificity of this CYTB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYTB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cytochrome b

Target: Cytochrome b (MT-CYB) (Mitochondrially Encoded Cytochrome B (MT-CYB))

Andere Bezeichnung: CYTB (MT-CYB Produkte)

Synonyme: cytB antikoerper, cytb antikoerper, MTCYB antikoerper, cytochrome b antikoerper, CYTB antikoerper

Hintergrund: CYTB belongs to the cytochrome b family. It is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Proton Transport