BTNL9 Antikörper (N-Term)

Produktnummer ABIN635592

Dieses Anti-BTNL9-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von BTNL9 in WB. Geeignet für Human.

Kurzübersicht für BTNL9 Antikörper (N-Term) (ABIN635592)

Target: BTNL9 (Butyrophilin-Like 9 (BTNL9))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BTNL9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-BTNL9 Antikörper

Bindungsspezifität: N-Term

Spezifität: BTNL9 antibody was raised against the N terminal of BTNL9

Aufreinigung: Affinity purified

Immunogen: BTNL9 antibody was raised using the N terminal of BTNL9 corresponding to a region with amino acids EIRWFRSQTFNVVHLYQEQQELPGRQMPAFRNRTKLVKDDIAYGSVVLQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BTNL9 Blocking Peptide, (ABIN937871), is also available for use as a blocking control in assays to test for specificity of this BTNL9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BTNL9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BTNL9

Target: BTNL9 (Butyrophilin-Like 9 (BTNL9))

Andere Bezeichnung: BTNL9

Hintergrund: The specific function of BTNL9 is not yet known.

Molekulargewicht: 60 kDa (MW of target protein)