VSIG1 Antikörper (N-Term)

Produktnummer ABIN635590

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch VSIG1 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für VSIG1 Antikörper (N-Term) (ABIN635590)

Target: VSIG1 (V-Set and Immunoglobulin Domain Containing 1 (VSIG1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VSIG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-VSIG1 Antikörper

Bindungsspezifität: N-Term

Spezifität: VSIG1 antibody was raised against the N terminal of VSIG1

Aufreinigung: Affinity purified

Immunogen: VSIG1 antibody was raised using the N terminal of VSIG1 corresponding to a region with amino acids SIYFSQGGQAVAIGQFKDRITGSNDPGNASITISHMQPADSGIYICDVNN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VSIG1 Blocking Peptide, (ABIN5616983), is also available for use as a blocking control in assays to test for specificity of this VSIG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VSIG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VSIG1

Target: VSIG1 (V-Set and Immunoglobulin Domain Containing 1 (VSIG1))

Andere Bezeichnung: VSIG1

Hintergrund: The function of VSIG1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 42 kDa (MW of target protein)