TECR Antikörper (Middle Region)

Produktnummer ABIN635589

Dieses Anti-TECR-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von TECR in WB. Geeignet für Human, Maus und Ratte.

Kurzübersicht für TECR Antikörper (Middle Region) (ABIN635589)

Target: TECR (Trans-2,3-Enoyl-CoA Reductase (TECR))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TECR Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TECR Antikörper

Bindungsspezifität: Middle Region

Spezifität: GPSN2 antibody was raised against the middle region of GPSN2

Aufreinigung: Affinity purified

Immunogen: GPSN2 antibody was raised using the middle region of GPSN2 corresponding to a region with amino acids PFIYGHKYDFTSSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GPSN2 Blocking Peptide, (ABIN5613845), is also available for use as a blocking control in assays to test for specificity of this GPSN2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPSN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TECR

Target: TECR (Trans-2,3-Enoyl-CoA Reductase (TECR))

Andere Bezeichnung: GPSN2

Hintergrund: Microsomal long and very long chain fatty acid elongation uses malonyl-CoA as the 2-carbon donor and consists of 4 sequential reactions. GPSN2 catalyzes the final step, reducing trans-2,3-enoyl-CoA to saturated acyl-CoA.

Molekulargewicht: 36 kDa (MW of target protein)