LRRC37A3 Antikörper (Middle Region)

Produktnummer ABIN635583

Produktdetails anti-LRRC37A3 Antikörper

Target: LRRC37A3 (Leucine Rich Repeat Containing 37, Member A3 (LRRC37A3))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC37A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LRRC37 A3 antibody was raised against the middle region of LRRC37 3

Aufreinigung: Affinity purified

Immunogen: LRRC37 A3 antibody was raised using the middle region of LRRC37 3 corresponding to a region with amino acids NYTSTELIIEPEEPSDSSGINLSGFGSEQLDTNDESDVTSTLSYILPYFS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC37A3 Blocking Peptide, catalog no. 33R-6945, is also available for use as a blocking control in assays to test for specificity of this LRRC37A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC30 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC37A3

Target: LRRC37A3 (Leucine Rich Repeat Containing 37, Member A3 (LRRC37A3))

Andere Bezeichnung: LRRC37A3 (LRRC37A3 Produkte)

Synonyme: LRRC37A antikoerper, Lrrc37a3 antikoerper, RGD1559753 antikoerper, leucine rich repeat containing 37 member A3 antikoerper, leucine rich repeat containing 37A antikoerper, leucine-rich repeat-containing protein 37A2 antikoerper, leucine-rich repeat-containing protein 37A3 antikoerper, LRRC37A3 antikoerper, Lrrc37a antikoerper, LOC454756 antikoerper, LOC714675 antikoerper

Hintergrund: The function of LRRC37A3 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 180 kDa (MW of target protein)