Sphingomyelin Synthase 1 Antikörper (Middle Region)

Produktnummer ABIN635582

Produktdetails anti-Sphingomyelin Synthase 1 Antikörper

Target: Sphingomyelin Synthase 1 (SGMS1)

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Sphingomyelin Synthase 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SGMS1 antibody was raised against the middle region of SGMS1

Aufreinigung: Affinity purified

Immunogen: SGMS1 antibody was raised using the middle region of SGMS1 corresponding to a region with amino acids SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SGMS1 Blocking Peptide, catalog no. 33R-8327, is also available for use as a blocking control in assays to test for specificity of this SGMS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGMS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Sphingomyelin Synthase 1

Target: Sphingomyelin Synthase 1 (SGMS1)

Andere Bezeichnung: SGMS1 (SGMS1 Produkte)

Synonyme: MGC81436 antikoerper, TMEM23 antikoerper, MOB antikoerper, MOB1 antikoerper, SMS1 antikoerper, hmob33 antikoerper, 9530058O11Rik antikoerper, AI841905 antikoerper, C80702 antikoerper, Mob antikoerper, Sms1 antikoerper, Sor1 antikoerper, Tmem23 antikoerper, sphingomyelin synthase 1 antikoerper, sphingomyelin synthase 1 S homeolog antikoerper, phosphatidylcholine:ceramide cholinephosphotransferase 1 antikoerper, SGMS1 antikoerper, sgms1.S antikoerper, LOC100013212 antikoerper, Sgms1 antikoerper

Hintergrund: SGMS1 is predicted to be a five-pass transmembrane protein. This gene may be predominately expressed in brain.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin