Sphingomyelin Synthase 1 Antikörper (Middle Region)

Produktnummer ABIN635582

Der Kaninchen Polyklonal anti-Sphingomyelin Synthase 1 Antikörper wird verwendet zum Nachweis von Sphingomyelin Synthase 1 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für Sphingomyelin Synthase 1 Antikörper (Middle Region) (ABIN635582)

Target: Sphingomyelin Synthase 1 (SGMS1)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Sphingomyelin Synthase 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Sphingomyelin Synthase 1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SGMS1 antibody was raised against the middle region of SGMS1

Aufreinigung: Affinity purified

Immunogen: SGMS1 antibody was raised using the middle region of SGMS1 corresponding to a region with amino acids SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SGMS1 Blocking Peptide, (ABIN5616119), is also available for use as a blocking control in assays to test for specificity of this SGMS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SGMS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Sphingomyelin Synthase 1

Target: Sphingomyelin Synthase 1 (SGMS1)

Andere Bezeichnung: SGMS1

Hintergrund: SGMS1 is predicted to be a five-pass transmembrane protein. This gene may be predominately expressed in brain.

Molekulargewicht: 48 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin