PLP1 Antikörper

Produktnummer ABIN635572

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PLP1 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Ratte, Maus und Hund.

Kurzübersicht für PLP1 Antikörper (ABIN635572)

Target: PLP1 (Proteolipid Protein 1 (PLP1))

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PLP1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PLP1 Antikörper

Aufreinigung: Affinity purified

Immunogen: PLP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PLP1 Blocking Peptide, (ABIN938693), is also available for use as a blocking control in assays to test for specificity of this PLP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PLP1

Target: PLP1 (Proteolipid Protein 1 (PLP1))

Andere Bezeichnung: PLP1

Hintergrund: PLP1 is a transmembrane proteolipid protein that is the predominant myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Alternatively spliced transcript variants encoding distinct isoforms or having different 5' UTRs, have been identified for this gene.

Molekulargewicht: 30 kDa (MW of target protein)