UBAC2 Antikörper (Middle Region)

Produktnummer ABIN635562

Der Kaninchen Polyklonal anti-UBAC2 Antikörper (ABIN635562) detektiert spezifisch UBAC2 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human und Maus.

Kurzübersicht für UBAC2 Antikörper (Middle Region) (ABIN635562)

Target: UBAC2 (UBA Domain Containing 2 (UBAC2))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBAC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UBAC2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: UBAC2 antibody was raised against the middle region of UBAC2

Aufreinigung: Affinity purified

Immunogen: UBAC2 antibody was raised using the middle region of UBAC2 corresponding to a region with amino acids YCSIPRVQVAQILGPLSITNKTLIYILGLQLFTSGSYIWIVAISGLMSGL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBAC2 Blocking Peptide, (ABIN936019), is also available for use as a blocking control in assays to test for specificity of this UBAC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBAC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBAC2

Target: UBAC2 (UBA Domain Containing 2 (UBAC2))

Andere Bezeichnung: UBAC2

Hintergrund: The function of UBAC2 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 35 kDa (MW of target protein)