TMEM209 Antikörper (N-Term)

Produktnummer ABIN635561

Produktdetails anti-TMEM209 Antikörper

Target: TMEM209 (Transmembrane Protein 209 (TMEM209))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM209 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FLJ14803 antibody was raised against the N terminal Of Flj14803

Aufreinigung: Affinity purified

Immunogen: FLJ14803 antibody was raised using the N terminal Of Flj14803 corresponding to a region with amino acids MMQGEAHPSASLIDRTIKMRKETEARKVVLAWGLLNVSMAGMIYTEMTGK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FLJ14803 Blocking Peptide, catalog no. 33R-6235, is also available for use as a blocking control in assays to test for specificity of this FLJ14803 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ14803 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM209

Target: TMEM209 (Transmembrane Protein 209 (TMEM209))

Andere Bezeichnung: FLJ14803 (TMEM209 Produkte)

Synonyme: flj14803 antikoerper, fc20f10 antikoerper, wu:fc20f10 antikoerper, NET31 antikoerper, 2700094F01Rik antikoerper, AI428435 antikoerper, RGD1309682 antikoerper, transmembrane protein 209 antikoerper, transmembrane protein 209 S homeolog antikoerper, tmem209 antikoerper, TMEM209 antikoerper, Tmem209 antikoerper, tmem209.S antikoerper

Hintergrund: The specific function of FLJ14803 is not yet known.

Molekulargewicht: 62 kDa (MW of target protein)