PIPOX Antikörper (C-Term)

Produktnummer ABIN635559

Produktdetails anti-PIPOX Antikörper

Target: PIPOX (Pipecolic Acid Oxidase (PIPOX))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PIPOX Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PIPOX antibody was raised against the C terminal of PIPOX

Aufreinigung: Affinity purified

Immunogen: PIPOX antibody was raised using the C terminal of PIPOX corresponding to a region with amino acids FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIPOX Blocking Peptide, catalog no. 33R-3119, is also available for use as a blocking control in assays to test for specificity of this PIPOX antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIPOX antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PIPOX

Target: PIPOX (Pipecolic Acid Oxidase (PIPOX))

Andere Bezeichnung: PIPOX (PIPOX Produkte)

Synonyme: LPIPOX antikoerper, Pso antikoerper, SOX antikoerper, pipecolic acid and sarcosine oxidase antikoerper, pipecolic acid oxidase antikoerper, pipecolic acid oxidase L homeolog antikoerper, PIPOX antikoerper, Pipox antikoerper, pipox antikoerper, pipox.L antikoerper

Hintergrund: PIPOX metabolizes sarcosine, L-pipecolic acid and L-proline.

Molekulargewicht: 43 kDa (MW of target protein)