TXNDC16 Antikörper (N-Term)

Produktnummer ABIN635558

Produktdetails anti-TXNDC16 Antikörper

Target: TXNDC16 (Thioredoxin Domain Containing 16 (TXNDC16))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TXNDC16 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TXNDC16 antibody was raised against the N terminal of TXNDC16

Aufreinigung: Affinity purified

Immunogen: TXNDC16 antibody was raised using the N terminal of TXNDC16 corresponding to a region with amino acids EVAEDPQQVSTVHLQLGLPLVFIVSQQATYEADRRTAEWVAWRLLGKAGV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TXNDC16 Blocking Peptide, catalog no. 33R-2774, is also available for use as a blocking control in assays to test for specificity of this TXNDC16 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNDC16 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TXNDC16

Target: TXNDC16 (Thioredoxin Domain Containing 16 (TXNDC16))

Andere Bezeichnung: TXNDC16 (TXNDC16 Produkte)

Synonyme: ERp90 antikoerper, KIAA1344 antikoerper, 5730420B22Rik antikoerper, C77647 antikoerper, RGD1306755 antikoerper, thioredoxin domain containing 16 antikoerper, TXNDC16 antikoerper, Txndc16 antikoerper

Hintergrund: TXNDC16 contains 1 thioredoxin domain. The exact function of TXNDC16 remains unknown.

Molekulargewicht: 93 kDa (MW of target protein)