CRTAP Antikörper (N-Term)
-
- Target Alle CRTAP Antikörper anzeigen
- CRTAP (Cartilage Associated Protein (CRTAP))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CRTAP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CRTAP antibody was raised against the N terminal of CRTAP
- Aufreinigung
- Affinity purified
- Immunogen
- CRTAP antibody was raised using the N terminal of CRTAP corresponding to a region with amino acids RLFGGLLRRAHCLKRCKQGLPAFRQSQPSREVLADFQRREPYKFLQFAYF
- Top Product
- Discover our top product CRTAP Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CRTAP Blocking Peptide, catalog no. 33R-8020, is also available for use as a blocking control in assays to test for specificity of this CRTAP antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRTAP antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CRTAP (Cartilage Associated Protein (CRTAP))
- Andere Bezeichnung
- CRTAP (CRTAP Produkte)
- Synonyme
- zgc:85621 antikoerper, wu:fb47h01 antikoerper, CASP antikoerper, LEPREL3 antikoerper, OI7 antikoerper, 5730529N23Rik antikoerper, Leprel3 antikoerper, RGD1565180 antikoerper, cartilage associated protein antikoerper, cartilage-associated protein antikoerper, crtap antikoerper, CRTAP antikoerper, LOC5574430 antikoerper, CpipJ_CPIJ013810 antikoerper, Crtap antikoerper
- Hintergrund
- The protein encoded by this gene is similar to the chicken and mouse CRTAP genes. The encoded protein is a scaffolding protein that may influence the activity of at least one member of the cytohesin/ARNO family in response to specific cellular stimuli.
- Molekulargewicht
- 44 kDa (MW of target protein)
-